SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148839372|ref|NP_057700.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148839372|ref|NP_057700.3|
Domain Number 1 Region: 449-586
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 3.4e-37
Family Nucleoside diphosphate kinase, NDK 0.00039
Further Details:      
 
Domain Number 2 Region: 315-449
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.83e-33
Family Nucleoside diphosphate kinase, NDK 0.00051
Further Details:      
 
Domain Number 3 Region: 155-312
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 3.01e-23
Family Nucleoside diphosphate kinase, NDK 0.0042
Further Details:      
 
Domain Number 4 Region: 13-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.3e-16
Family Thioltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148839372|ref|NP_057700.3|
Sequence length 588
Comment thioredoxin domain-containing protein 3 [Homo sapiens]
Sequence
MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDE
ILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKI
AAGEMARPQYPEIPLVDSDSEVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKA
GFIIEAEHKTVLTEEQVVNFYSRIADQCDFEEFVSFMTSGLSYILVVSQGSKHNPPSEET
EPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFM
DAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQA
LCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQ
FAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDL
TQVKKMFLTPEQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTD
PEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPEEN
Download sequence
Identical sequences Q8N427
ENSP00000199447 ENSP00000199447 ENSP00000397063 gi|148839372|ref|NP_057700.3| 9606.ENSP00000199447 ENSP00000199447 ENSP00000397063 NP_057700.3.87134 NP_057700.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]