SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148839466|ref|NP_001019831.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148839466|ref|NP_001019831.2|
Domain Number 1 Region: 2673-2963
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1280-1459
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 3 Region: 1915-2114
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-51
Family DBL homology domain (DH-domain) 0.0000147
Further Details:      
 
Domain Number 4 Region: 1466-1586
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2115-2232
Classification Level Classification E-value
Superfamily PH domain-like 3.82e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 6 Region: 2502-2663
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 7 Region: 278-414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 8 Region: 1098-1235
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 9 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 10 Region: 840-1001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000408
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 2322-2385
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000833
Family SH3-domain 0.0000302
Further Details:      
 
Domain Number 12 Region: 35-181
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 13 Region: 1645-1710
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000258
Family SH3-domain 0.0035
Further Details:      
 
Domain Number 14 Region: 191-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 646-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000089
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148839466|ref|NP_001019831.2|
Sequence length 2986
Comment kalirin isoform 1 [Homo sapiens]
Sequence
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYI
HRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELK
DGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFL
FEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVL
KASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGD
GSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPS
ERPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSE
SVANLQAQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSF
DLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLL
AARQASTEVPTAADLVNAIEKLVKNKLSLEGSSYRGSLKDPAGCLNEGMAPPTPPKNPEE
EQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIH
QIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFE
EVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKR
CNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELL
RKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETSERVVLQAANADIQQAWVQD
INQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPARLPQASPRPYSSVPAGSEKPPKGS
SYNPPLPPLKISTSNGSPGFEYHQPGDKFEASKQNDLGGCNGTSSMAVIKDYYALKENEI
CVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATAAESSDGSIKKS
CSWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEI
LNPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNILDTDNSSAT
YTVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQER
SCTSVILRWLPPSSTGNCTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQF
RVSASNPWGISLPSEPSEFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKK
CIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELM
DDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRV
KLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPF
LDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQP
HNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
Download sequence
Identical sequences J3QSW6
gi|148839466|ref|NP_001019831.2| ENSP00000418790 ENSP00000353109 ENSP00000353109 NP_001019831.2.87134 NP_001019831.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]