SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148886654|ref|NP_699197.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148886654|ref|NP_699197.3|
Domain Number 1 Region: 1424-1624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.5e-40
Family Pentraxin (pentaxin) 0.00079
Further Details:      
 
Domain Number 2 Region: 79-259
Classification Level Classification E-value
Superfamily vWA-like 3.26e-39
Family Integrin A (or I) domain 0.00066
Further Details:      
 
Domain Number 3 Region: 2144-2213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-19
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 4 Region: 2831-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-18
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 5 Region: 3239-3308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 2379-2449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1961-2029
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 1787-1856
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 9 Region: 2773-2842
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 10 Region: 1845-1914
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2263-2331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 12 Region: 2715-2784
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.01e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 13 Region: 1688-1746
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 14 Region: 2671-2726
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 2889-2958
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2554-2621
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.31e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 3063-3130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 1903-1967
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2438-2507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 3298-3364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 21 Region: 2948-3010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000584
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 3416-3475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000625
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2496-2556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 24 Region: 437-504
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 25 Region: 1631-1699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 1294-1420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 27 Region: 376-447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000667
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 28 Region: 2322-2390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000107
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 29 Region: 2204-2268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000122
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 30 Region: 3007-3072
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 31 Region: 2018-2086
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 3357-3425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 3121-3184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000012
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 34 Region: 987-1131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000283
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 35 Region: 3181-3244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 36 Region: 2083-2150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000347
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 37 Region: 1230-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000695
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 38 Region: 1195-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000757
Family EGF-type module 0.015
Further Details:      
 
Domain Number 39 Region: 1741-1784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000389
Family EGF-type module 0.054
Further Details:      
 
Domain Number 40 Region: 496-553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000005
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 41 Region: 277-433
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000118
Family Growth factor receptor domain 0.0097
Further Details:      
 
Weak hits

Sequence:  gi|148886654|ref|NP_699197.3|
Domain Number - Region: 3467-3503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000192
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 3506-3535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 3535-3566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000474
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 727-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000846
Family Complement control module/SCR domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148886654|ref|NP_699197.3|
Sequence length 3571
Comment sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Homo sapiens]
Sequence
MWPRLAFCCWGLALVSGWATFQQMSPSRNFSFRLFPETAPGAPGSIPAPPAPGDEAAGSR
VERLGQAFRRRVRLLRELSERLELVFLVDDSSSVGEVNFRSELMFVRKLLSDFPVVPTAT
RVAIVTFSSKNYVVPRVDYISTRRARQHKCALLLQEIPAISYRGGGTYTKGAFQQAAQIL
LHARENSTKVVFLITDGYSNGGDPRPIAASLRDSGVEIFTFGIWQGNIRELNDMASTPKE
EHCYLLHSFEEFEALARRALHEDLPSGSFIQDDMVHCSYLCDEGKDCCDRMGSCKCGTHT
GHFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISSCIPCPDENHTSPPGSTSPEDC
VCREGYRASGQTCELVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSIILC
LPNGLWSGSESYCRVRTCPHLRQPKHGHISCSTREMLYKTTCLVACDEGYRLEGSDKLTC
QGNSQWDGPEPRCVERHCSTFQMPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKE
MLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSANVTWQIPTAKDNSGEK
VSVHVHPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVIDAEPPVIDWCRSPPPVQ
VSEKVHAASWDEPQFSDNSGAELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHI
VIKGSPCEIPFTPVNGDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTY
TTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDI
DCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS
SRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKD
PMYSFQLASEILIADSNSLETKKASPFCRPGSVLRGRMCVNCPLGTYYNLEHFTCESCRI
GSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPK
FGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFC
LACPFYGTTPFAGSRSITECSSFSSTFSAAEESVVPPASLGHIKKRHEISSQVFHECFFN
PCHNSGTCQQLGRGYVCLCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEFICECPSG
YTGQRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNA
VCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCKDGANSFRCLCAAGFTGSHC
ELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGKRCETEQSTGFNLDFEVSGIYGYVM
LDGMLPSLHALTCTFWMKSSDDMNYGTPISYAVDNGSDNTLLLTDYNGWVLYVNGREKIT
NCPSVNDGRWHHIAITWTSANGIWKVYIDGKLSDGGAGLSVGLPIPGGGALVLGQEQDKK
GEGFSPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGIVGKVK
IDSKSIFCSDCPRLGGSVPHLRTASEDLKPGSKVNLFCDPGFQLVGNPVQYCLNQGQWTQ
PLPHCERISCGVPPPLENGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGVS
PSCLDVDECAVGSDCSEHASCLNVDGSYICSCVPPYTGDGKNCAEPIKCKAPGNPENGHS
SGEIYTVGAEVTFSCQEGYQLMGVTKITCLESGEWNHLIPYCKAVSCGKPAIPENGCIEE
LAFTFGSKVTYRCNKGYTLAGDKESSCLANSSWSHSPPVCEPVKCSSPENINNGKYILSG
LTYLSTASYSCDTGYSLQGPSIIECTASGIWDRAPPACHLVFCGEPPAIKDAVITGNNFT
FRNTVTYTCKEGYTLAGLDTIECLADGKWSRSDQQCLAVSCDEPPIVDHASPETAHRLFG
DIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAHFCEKPPSVSYSILESVSKA
KFAAGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNGYASGS
NYSFGAMVAYSCNKGFYIKGEKKSTCEATGQWSSPIPTCHPVSCGEPPKVENGFLEHTTG
RIFESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPPIQNGFMKGENF
EVGSKVQFFCNEGYELVGDSSWTCQKSGKWNKKSNPKCMPAKCPEPPLLENQLVLKELTT
EVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKIVLCTPPPLISFGVPIPSSALHF
GSTVKYSCVGGFFLRGNSTTLCQPDGTWSSPLPECVPVECPQPEEIPNGIIDVQGLAYLS
TALYTCKPGFELVGNTTTLCGENGHWLGGKPTCKAIECLKPKEILNGKFSYTDLHYGQTV
TYSCNRGFRLEGPSALTCLETGDWDVDAPSCNAIHCDSPQPIENGFVEGADYSYGAIIIY
SCFPGFQVAGHAMQTCEESGWSSSIPTCMPIDCGLPPHIDFGDCTKLKDDQGYFEQEDDM
MEVPYVTPHPPYHLGAVAKTWENTKESPATHSSNFLYGTMVSYTCNPGYELLGNPVLICQ
EDGTWNGSAPSCISIECDLPTAPENGFLRFTETSMGSAVQYSCKPGHILAGSDLRLCLEN
RKWSGASPRCEAISCKKPNPVMNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQDDKN
WDEDEPICIPVDCSSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEGARSRVCLANGSWS
GATPDCVPVRCATPPQLANGVTEGLDYGFMKEVTFHCHEGYILHGAPKLTCQSDGNWDAE
IPLCKPVNCGPPEDLAHGFPNGFSFIHGGHIQYQCFPGYKLHGNSSRRCLSNGSWSGSSP
SCLPCRCSTPVIEYGTVNGTDFDCGKAARIQCFKGFKLLGLSEITCEADGQWSSGFPHCE
HTSCGSLPMIPNAFISETSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQPYPVCEPL
SCGSPPSVANAVATGEAHTYESEVKLRCLEGYTMDTDTDTFTCQKDGRWFPERISCSPKK
CPLPENITHILVHGDDFSVNRQVSVSCAEGYTFEGVNISVCQLDGTWEPPFSDESCSPVS
CGKPESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQENRQWSGGVAICKETRCE
TPLEFLNGKADIENRTTGPNVVYSCNRGYSLEGPSEAHCTENGTWSHPVPLCKPNPCPVP
FVIPENALLSEKEFYVDQNVSIKCREGFLLQGHGIITCNPDETWTQTSAKCEKISCGPPA
HVENAIARGVHYQYGDMITYSCYSGYMLEGFLRSVCLENGTWTSPPICRAVCRFPCQNGG
ICQRPNACSCPEGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQSPC
LNGGKCVRPNRCHCLSSWTGHNCSRKRRTGF
Download sequence
Identical sequences Q4LDE5
NP_699197.3.87134 NP_699197.3.92137 9606.ENSP00000384917 gi|148886654|ref|NP_699197.3| ENSP00000363593 ENSP00000384917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]