SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148922963|ref|NP_036291.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148922963|ref|NP_036291.2|
Domain Number 1 Region: 42-122
Classification Level Classification E-value
Superfamily F-box domain 1.09e-17
Family F-box domain 0.0028
Further Details:      
 
Domain Number 2 Region: 167-390
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000549
Family Cyclin A/CDK2-associated p19, Skp2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148922963|ref|NP_036291.2|
Sequence length 434
Comment F-box/LRR-repeat protein 21 [Homo sapiens]
Sequence
MKRNSLSVENKIVQLSGAAKQPKVGFYSSLNQTHTHTVLLDWGSLPHHVVLQIFQYLPLL
DRACASSVCRRWNEVFHISDLWRKFEFELNQSATSSFKSTHPDLIQQIIKKHFAHLQYVS
FKVDSSAESAEAACDILSQLVNCSIQTLGLISTAKPSFMNVSESHFVSALTVVFINSKSL
SSIKIEDTPVDDPSLKILVANNSDTLRLPKMSSCPHVSSDGILCVADRCQGLRELALNYY
ILTDELFLALSSETHVNLEHLRIDVVSENPGQIKFHAVKKHSWDALIKHSPRVNVVMHFF
LYEEEFETFFKEETPVTHLYFGRSVSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICI
AEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSK
YLGRVWFPDVMPLW
Download sequence
Identical sequences Q9UKT6
gi|148922963|ref|NP_036291.2| NP_036291.2.87134 NP_036291.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]