SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|149158723|ref|NP_112509.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|149158723|ref|NP_112509.3|
Domain Number 1 Region: 299-380
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 4.11e-16
Family PA3566-like 0.018
Further Details:      
 
Domain Number 2 Region: 26-99
Classification Level Classification E-value
Superfamily EF-hand 0.00000000872
Family Calmodulin-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|149158723|ref|NP_112509.3|
Sequence length 396
Comment N-terminal EF-hand calcium-binding protein 3 isoform 2 [Homo sapiens]
Sequence
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEE
FQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAV
LAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAES
VEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLEC
KVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQR
QVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQ
SPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
Download sequence
Identical sequences Q96P71
ENSP00000246190 9606.ENSP00000246190 ENSP00000246190 ENSP00000364386 gi|149158723|ref|NP_112509.3| NP_112509.3.87134 NP_112509.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]