SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|149158725|ref|NP_112508.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|149158725|ref|NP_112508.3|
Domain Number 1 Region: 265-346
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 3.53e-16
Family PA3566-like 0.018
Further Details:      
 
Domain Number 2 Region: 26-99
Classification Level Classification E-value
Superfamily EF-hand 0.00000000794
Family Calmodulin-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|149158725|ref|NP_112508.3|
Sequence length 362
Comment N-terminal EF-hand calcium-binding protein 3 isoform 1 [Homo sapiens]
Sequence
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEE
FQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAV
LAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAES
VEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLEC
KAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSA
QKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMN
NN
Download sequence
Identical sequences ENSP00000364386 NP_112508.3.87134 NP_112508.3.92137 gi|149158725|ref|NP_112508.3| ENSP00000364386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]