SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14916427|ref|NP_149111.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14916427|ref|NP_149111.1|
Domain Number 1 Region: 116-166
Classification Level Classification E-value
Superfamily EF-hand 0.000000316
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14916427|ref|NP_149111.1|
Sequence length 451
Comment protein naked cuticle homolog 2 [Homo sapiens]
Sequence
MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFR
EDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEE
DDRQEWTFTLYDFDNCGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPS
SKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDEN
TERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQ
VLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAV
LPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG
EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS
Download sequence
Identical sequences Q969F2
NP_149111.1.87134 NP_149111.1.92137 9606.ENSP00000296849 gi|14916427|ref|NP_149111.1| ENSP00000296849 ENSP00000296849 ENSP00000479003 ENSP00000274150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]