SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14916433|ref|NP_149110.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14916433|ref|NP_149110.1|
Domain Number 1 Region: 117-174
Classification Level Classification E-value
Superfamily EF-hand 0.000000115
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14916433|ref|NP_149110.1|
Sequence length 470
Comment protein naked cuticle homolog 1 [Homo sapiens]
Sequence
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIG
RSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLK
FEELQCDVSMEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKM
LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
EAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGH
VARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT
Download sequence
Identical sequences Q969G9
9606.ENSP00000268459 NP_149110.1.87134 NP_149110.1.92137 ENSP00000268459 GO.37148 ENSP00000268459 gi|14916433|ref|NP_149110.1| ENSP00000268459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]