SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|14916498|ref|NP_148935.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14916498|ref|NP_148935.1|
Domain Number 1 Region: 92-276
Classification Level Classification E-value
Superfamily L domain-like 1.8e-26
Family Ngr ectodomain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14916498|ref|NP_148935.1|
Sequence length 298
Comment mimecan preproprotein [Homo sapiens]
Sequence
MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEK
ETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE
SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLL
KLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIH
LQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF
Download sequence
Identical sequences A8K0R3 P20774
ENSP00000262551 ENSP00000364711 NP_054776.1.87134 NP_054776.1.92137 NP_148935.1.87134 NP_148935.1.92137 ENSP00000262551 gi|14916498|ref|NP_148935.1| gi|7661704|ref|NP_054776.1| ENSP00000262551 ENSP00000364711 9606.ENSP00000262551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]