SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|149773484|ref|NP_065913.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|149773484|ref|NP_065913.1|
Domain Number 1 Region: 39-302
Classification Level Classification E-value
Superfamily L domain-like 5.95e-42
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 297-396
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 426-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000498
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|149773484|ref|NP_065913.1|
Sequence length 771
Comment leucine-rich repeat and fibronectin type III domain-containing protein 1 precursor [Homo sapiens]
Sequence
MAPGPFSSALLSPPPAALPFLLLLWAGASRGQPCPGRCICQNVAPTLTMLCAKTGLLFVP
PAIDRRVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHL
DSNRLAEVRGDQLRGLGNLRHLILGNNQIRRVESAAFDAFLSTVEDLDLSYNNLEALPWE
AVGQMVNLNTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGTGPK
PPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPL
ITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVRGDGTLDVTIT
TLRDSGTFTCIASNAAGEATAPVEVCVVPLPLMAPPPAAPPPLTEPGSSDIATPGRPGAN
DSAAERRLVAAELTSNSVLIRWPAQRPVPGIRMYQVQYNSSVDDSLVYRMIPSTSQTFLV
NDLAAGRAYDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRAHFLGGTMIIAI
GGVIVASVLVFIVLLMIRYKVYGDGDSRRVKGSRSLPRVSHVCSQTNGAGTGAAQAPALP
AQDHYEALREVESQAAPAVAVEAKAMEAETASAEPEVVLGRSLGGSATSLCLLPSEETSG
EESRAAVGPRRSRSGALEPPTSAPPTLALVPGGAAARPRPQQRYSFDGDYGALFQSHSYP
RRARRTKRHRSTPHLDGAGGGAAGEDGDLGLGSARACLAFTSTEWMLESTV
Download sequence
Identical sequences Q9P244
NYSGRC-IgSF-LRFN1_HUMAN ENSP00000248668 gi|149773484|ref|NP_065913.1| ENSP00000248668 NP_065913.1.87134 NP_065913.1.92137 XP_005259159.1.92137 XP_016882522.1.92137 ENSP00000248668 9606.ENSP00000248668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]