SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|149944496|ref|NP_056377.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|149944496|ref|NP_056377.1|
Domain Number 1 Region: 133-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-43
Family UAS domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 376-488
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-28
Family UBX domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 13-54
Classification Level Classification E-value
Superfamily UBA-like 0.000000587
Family TAP-C domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|149944496|ref|NP_056377.1|
Sequence length 489
Comment UBX domain-containing protein 7 [Homo sapiens]
Sequence
MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPS
TSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIR
QEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFAC
QCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLV
EWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQE
THFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKSPHKDLGHRKE
ENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYP
DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQ
ETVFVQERN
Download sequence
Identical sequences A0A2J8RG98 G3RFM8 K7CGS0 O94888 Q5REY7
ENSPPYP00000016149 NP_056377.1.87134 NP_056377.1.92137 XP_018879957.1.27298 gi|149944496|ref|NP_056377.1| ENSP00000296328 ENSPPYP00000016149 ENSP00000296328 9598.ENSPTRP00000027155 9600.ENSPPYP00000016149 9606.ENSP00000296328 ENSP00000296328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]