SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|149944593|ref|NP_056112.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|149944593|ref|NP_056112.1|
Domain Number 1 Region: 117-203
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.15e-46
Family variant PHD-like domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 195-276
Classification Level Classification E-value
Superfamily EF-hand 0.00000819
Family EF-hand modules in multidomain proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|149944593|ref|NP_056112.1|
Sequence length 400
Comment hypothetical protein LOC23349 [Homo sapiens]
Sequence
MGVLMSKRQTVEQVQKVSLAVSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKE
AEAGTSVVQEESSAGRAAWERLRDGRGVEPEEFDRTSRFTPPAFIRPTRKLDDDKPPEIC
LEPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTEMAHTE
TGWSCHYCDNINLLLTEEEMYSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRAL
SEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARA
AFLARGSGSTVSEAECRRAQHSWFCKRFPEAPSCSVSISHVGPIADSSPASSSSKSQDKT
LLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHLKPPG
Download sequence
Identical sequences Q9UPV7
NP_001291262.1.87134 NP_001291262.1.92137 NP_056112.1.87134 NP_056112.1.92137 ENSP00000242315 ENSP00000444138 ENSP00000242315 gi|149944593|ref|NP_056112.1| 9606.ENSP00000242315 ENSP00000242315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]