SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150010678|ref|NP_570128.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150010678|ref|NP_570128.2|
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily EF-hand 7.86e-24
Family S100 proteins 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150010678|ref|NP_570128.2|
Sequence length 99
Comment protein S100-Z [Homo sapiens]
Sequence
MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQ
DLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Download sequence
Identical sequences Q8WXG8
ENSP00000320430 ENSGGOP00000028098 ENSP00000320430 ENSP00000426768 gi|150010678|ref|NP_570128.2| NP_570128.2.87134 NP_570128.2.92137 XP_011541541.1.92137 XP_011541542.1.92137 XP_011541543.1.92137 XP_011541546.1.92137 XP_011541547.1.92137 XP_016864660.1.92137 XP_016864661.1.92137 XP_016864662.1.92137 9606.ENSP00000320430 5hyd_A 5hyd_B 5hyd_C 5hyd_D ENSGGOP00000028098 ENSP00000320430 ENSP00000426768 ENSP00000483535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]