SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150170653|ref|NP_775855.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150170653|ref|NP_775855.3|
Domain Number 1 Region: 32-100
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000194
Family Parvalbumin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150170653|ref|NP_775855.3|
Sequence length 294
Comment EF-hand calcium-binding domain-containing protein 4A [Homo sapiens]
Sequence
MASPGKPGADEAQEEEGELEGGSAGPRAAILEQAEELFLLCDKEAKGFITKHDLQGLQSD
LPLTPEQLEAVFESLDRAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLD
VQGTAGSLDEEEEEEERFHTVLEQLGVAPVLGKQRAVRTLWARLQRERPELLGSFEDVLI
RASACLEEAARERDGLEQALRRRESEHEREVRALYEETEQLREQSRRPPSQNFARGERRS
RLELELQSREQDLERAGLRQRERRGRRLQEHAERESQPATATGAAQGAEYTAAG
Download sequence
Identical sequences ENSP00000409256 ENSP00000432334 NP_775855.3.87134 NP_775855.3.92137 XP_016873088.1.92137 gi|150170653|ref|NP_775855.3| 9606.ENSP00000324024 ENSP00000409256 ENSP00000432334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]