SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15029530|ref|NP_071426.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15029530|ref|NP_071426.1|
Domain Number 1 Region: 45-350
Classification Level Classification E-value
Superfamily L domain-like 5.71e-58
Family Ngr ectodomain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 352-441
Classification Level Classification E-value
Superfamily Immunoglobulin 5.43e-17
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15029530|ref|NP_071426.1|
Sequence length 653
Comment leucine-rich repeat-containing protein 4 precursor [Homo sapiens]
Sequence
MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVV
CTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFN
GLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGE
LKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHG
LSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHN
PWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPR
DLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTS
TGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLA
AAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPT
IHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Download sequence
Identical sequences K7C1L6 Q9HBW1
ENSP00000249363 NP_071426.1.87134 NP_071426.1.92137 XP_001151566.1.37143 XP_003806095.1.60992 XP_011514763.1.92137 XP_016867994.1.92137 ENSPTRP00000033656 9598.ENSPTRP00000033656 9606.ENSP00000249363 ENSP00000249363 gi|15029530|ref|NP_071426.1| ENSPTRP00000033656 NYSGRC-IgSF-LRRC4_HUMAN ENSP00000249363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]