SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|151101292|ref|NP_110382.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|151101292|ref|NP_110382.3|
Domain Number 1 Region: 26-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.92e-27
Family PDI-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|151101292|ref|NP_110382.3|
Sequence length 280
Comment thioredoxin-related transmembrane protein 1 precursor [Homo sapiens]
Sequence
MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQ
NLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTK
KDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGS
YTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQE
ADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
Download sequence
Identical sequences Q9H3N1
NP_110382.3.87134 NP_110382.3.92137 9606.ENSP00000393316 ENSP00000393316 ENSP00000393316 ENSP00000393316 gi|151101292|ref|NP_110382.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]