SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153070264|ref|NP_005916.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153070264|ref|NP_005916.2|
Domain Number 1 Region: 67-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-52
Family Astacin 0.00013
Further Details:      
 
Domain Number 2 Region: 426-589
Classification Level Classification E-value
Superfamily TRAF domain-like 1.55e-34
Family MATH domain 0.0017
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-29
Family MAM domain 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|153070264|ref|NP_005916.2|
Domain Number - Region: 606-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00032
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153070264|ref|NP_005916.2|
Sequence length 701
Comment meprin A subunit beta precursor [Homo sapiens]
Sequence
MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
NMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGSESDQLNIYIR
EYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLI
SGANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVG
TVALFSNGTQFRRGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTP
APSVQDLCSKTTCKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSST
VAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHAF
Download sequence
Identical sequences Q16820
ENSP00000269202 9606.ENSP00000269202 NYSGRC-153070264 NP_005916.2.87134 NP_005916.2.92137 gi|153070264|ref|NP_005916.2| ENSP00000269202 ENSP00000269202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]