SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153791330|ref|NP_065924.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153791330|ref|NP_065924.3|
Domain Number 1 Region: 34-391
Classification Level Classification E-value
Superfamily L domain-like 3.4e-61
Family Ngr ectodomain-like 0.059
Further Details:      
 
Domain Number 2 Region: 424-516
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 527-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000039
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153791330|ref|NP_065924.3|
Sequence length 716
Comment leucine-rich repeat neuronal protein 1 precursor [Homo sapiens]
Sequence
MARMSFVIAACQLVLGLLMTSLTESSIQNSECPQLCVCEIRPWFTPQSTYREATTVDCND
LRLTRIPSNLSSDTQVLLLQSNNIAKTVDELQQLFNLTELDFSQNNFTNIKEVGLANLTQ
LTTLHLEENQITEMTDYCLQDLSNLQELYINHNQISTISAHAFAGLKNLLRLHLNSNKLK
VIDSRWFDSTPNLEILMIGENPVIGILDMNFKPLANLRSLVLAGMYLTDIPGNALVGLDS
LESLSFYDNKLVKVPQLALQKVPNLKFLDLNKNPIHKIQEGDFKNMLRLKELGINNMGEL
VSVDRYALDNLPELTKLEATNNPKLSYIHRLAFRSVPALESLMLNNNALNAIYQKTVESL
PNLREISIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSE
QCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSS
EGTLEISNIQIEDSGRYTCVAQNVQGADTRVATIKVNGTLLDGTQVLKIYVKQTESHSIL
VSWKVNSNVMTSNLKWSSATMKIDNPHITYTARVPVDVHEYNLTHLQPSTDYEVCLTVSN
IHQQTQKSCVNVTTKNAAFAVDISDQETSTALAAVMGSMFAVISLASIAVYFAKRFKRKN
YHHSLKKYMQKTSSIPLNELYPPLINLWEGDSEKDKDGSADTKPTQVDTSRSYYMW
Download sequence
Identical sequences Q6UXK5
ENSP00000314901 ENSP00000314901 NP_001311117.1.87134 NP_001311117.1.92137 NP_001311118.1.87134 NP_001311118.1.92137 NP_065924.3.87134 NP_065924.3.92137 gi|153791330|ref|NP_065924.3| 9606.ENSP00000314901 ENSP00000314901 NYSGRC-IgSF-LRRN1_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]