SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153791377|ref|NP_077286.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153791377|ref|NP_077286.3|
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-28
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 148-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.56e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153791377|ref|NP_077286.3|
Sequence length 279
Comment pleckstrin homology domain-containing family F member 1 [Homo sapiens]
Sequence
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQ
EWISHIEECVRRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRQRFLLPRLSPKPVRVCSLCYRELAAQQRQEEAEEQGAGSPGQPAHLARPICG
ASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
Download sequence
Identical sequences Q96S99
9606.ENSP00000299373 ENSP00000389787 NP_077286.3.87134 NP_077286.3.92137 XP_011525611.1.92137 gi|153791377|ref|NP_077286.3| ENSP00000389787 ENSP00000466292 ENSP00000389787 ENSP00000466292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]