SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153791414|ref|NP_001093161.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153791414|ref|NP_001093161.1|
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000213
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153791414|ref|NP_001093161.1|
Sequence length 159
Comment protransforming growth factor alpha isoform 2 preproprotein [Homo sapiens]
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Download sequence
Identical sequences A0A2I2ZBF2 H2QI26
ENSP00000404099 NP_001093161.1.87134 NP_001093161.1.92137 XP_009440908.1.37143 XP_012356575.1.23891 XP_018877141.1.27298 gi|153791414|ref|NP_001093161.1| ENSP00000404099 ENSP00000475689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]