SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153792227|ref|NP_060804.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153792227|ref|NP_060804.3|
Domain Number 1 Region: 42-382
Classification Level Classification E-value
Superfamily L domain-like 2.98e-56
Family Ngr ectodomain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 426-513
Classification Level Classification E-value
Superfamily Immunoglobulin 3.1e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 526-593
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000129
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153792227|ref|NP_060804.3|
Sequence length 708
Comment leucine-rich repeat neuronal protein 3 precursor [Homo sapiens]
Sequence
MKDMPLRIHVLLGLAITTLVQAVDKKVDCPRLCTCEIRPWFTPRSIYMEASTVDCNDLGL
LTFPARLPANTQILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLS
VYLEENKLTELPEKCLSELSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN
SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES
ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI
DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL
KEISIHSNPIRCDCVIRWMNMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFRDMMEICL
PLIAPESFPSNLNVEAGSYVSFHCRATAEPQPEIYWITPSGQKLLPNTLTDKFYVHSEGT
LDINGVTPKEGGLYTCIATNLVGADLKSVMIKVDGSFPQDNNGSLNIKIRDIQANSVLVS
WKASSKILKSSVKWTAFVKTENSHAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQ
KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLSPEMNCDGGHS
YVRNYLQKPTFALGELYPPLINLWEAGKEKSTSLKVKATVIGLPTNMS
Download sequence
Identical sequences A4D0T1 H2R507 Q9H3W5
NP_001093128.1.87134 NP_001093128.1.92137 NP_001093130.1.87134 NP_001093130.1.92137 NP_060804.3.87134 NP_060804.3.92137 XP_001166878.1.37143 XP_527861.1.37143 ENSP00000312001 ENSP00000397312 ENSP00000412417 NYSGRC-IgSF-LRRN3_HUMAN gi|153791507|ref|NP_001093130.1| gi|153792227|ref|NP_060804.3| gi|153792651|ref|NP_001093128.1| ENSP00000312001 ENSP00000397312 ENSP00000412417 9598.ENSPTRP00000047686 9606.ENSP00000312001 ENSP00000312001 ENSPTRP00000047686 ENSPTRP00000047686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]