SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153792305|ref|NP_001093148.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153792305|ref|NP_001093148.1|
Domain Number 1 Region: 45-298
Classification Level Classification E-value
Superfamily L domain-like 1e-41
Family Ngr ectodomain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153792305|ref|NP_001093148.1|
Sequence length 371
Comment leucine-rich repeat-containing protein 58 [Homo sapiens]
Sequence
MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLP
RALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCR
SLQVLNLSGNCFQEVPASLLELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKE
IPPELGNLPSLNYLVLCDNKIQSIPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
SLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCPNPK
CGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASV
AARRMQKVLLG
Download sequence
Identical sequences Q96CX6
ENSP00000295628 ENSP00000295628 NP_001093148.1.87134 NP_001093148.1.92137 gi|153792305|ref|NP_001093148.1| ENSP00000295628 9606.ENSP00000295628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]