SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153945800|ref|NP_001093584.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153945800|ref|NP_001093584.1|
Domain Number 1 Region: 179-409
Classification Level Classification E-value
Superfamily RNI-like 1.41e-20
Family 28-residue LRR 0.045
Further Details:      
 
Weak hits

Sequence:  gi|153945800|ref|NP_001093584.1|
Domain Number - Region: 78-170
Classification Level Classification E-value
Superfamily RUN domain-like 0.0314
Family RUN domain 0.014
Further Details:      
 
Domain Number - Region: 454-469
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.0693
Family NOB1 zinc finger-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153945800|ref|NP_001093584.1|
Sequence length 475
Comment PRAME family member 20/21 [Homo sapiens]
Sequence
MSIRTPPRLLELAGRSLLRDEALAISTLEELPTELFPPLFMEAFSRRHCEALKLMVQAWP
FLRLPLGSLMKRPCPETFQAVLDGLDALLTHRVRLRRWKLQVLDLQDVSENFWMVWSEAM
ARRCLPNAMMNRKPVQDCPRMRGQQPLTVFIDLCLKNRTLDEYFTCLFLWVKQREGLVHL
CCKKLKMLGMLFHNIRNILKTVNLDCIQEVEVNCNWTLPVLAEFTPYLGQMRNLRKLVLS
DIDSRYISPEQKKEFVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQMLSCLKTSLNILAI
TNCVLLESDLKHLSKYPSIGQLKTLDLSGTRLANFSLVPLQVLLEKVAATLEYLDLDDCG
IVDSQVNAILPALSRCFELTTFSFRGNPISTATLENLLCHTIRLNNLCLELYPAPRESYD
VRGIVCRSRFAQLGAELMGRVRALREPERILFCTDYCPQCGNRSLYDLEVDRCCC
Download sequence
Identical sequences 9606.ENSP00000331921 9606.ENSP00000346275 gi|153792112|ref|NP_001093322.1| gi|153945800|ref|NP_001093584.1| HR6136 ENSP00000331921 ENSP00000333197 ENSP00000346275 ENSP00000473584 ENSP00000331921 ENSP00000346275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]