SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153945858|ref|NP_002089.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153945858|ref|NP_002089.4|
Domain Number 1 Region: 14-184
Classification Level Classification E-value
Superfamily EF-hand 3.3e-40
Family Calmodulin-like 0.000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153945858|ref|NP_002089.4|
Sequence length 200
Comment guanylyl cyclase-activating protein 2 [Homo sapiens]
Sequence
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG
IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML
QMDMNPSSWLAQQRRKSAMF
Download sequence
Identical sequences A0A2J8Y484 A0A2K5HGT0 A0A2K6D6U8 A0A2K6M252 A0A2K6Q1T5 F6XR41 G3RAL2 G7P3X9 H2QT03 Q9UMX6
ENSP00000230361 ENSMMUP00000005331 ENSGGOP00000012485 ENSPTRP00000031040 9544.ENSMMUP00000005331 9598.ENSPTRP00000031040 9606.ENSP00000230361 ENSP00000230361 ENSPTRP00000031040 ENSMMUP00000005331 gi|153945858|ref|NP_002089.4| NP_002089.4.87134 NP_002089.4.92137 XP_001086988.1.72884 XP_002816938.1.23681 XP_003833344.1.60992 XP_004044062.1.27298 XP_005553062.1.63531 XP_010367963.1.97406 XP_011752841.1.29376 XP_011799022.1.43180 XP_017733730.1.44346 XP_527386.2.37143 ENSP00000230361 ENSGGOP00000012485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]