SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153946395|ref|NP_002151.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153946395|ref|NP_002151.2|
Domain Number 1 Region: 1971-2194
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.27e-80
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1063
Classification Level Classification E-value
Superfamily Fibronectin type III 7.74e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1801-1965
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-21
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 1708-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 7.69e-20
Family Fibronectin type III 0.0000204
Further Details:      
 
Domain Number 5 Region: 624-788
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1260-1344
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000273
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000535
Family Fibronectin type III 0.00000287
Further Details:      
 
Domain Number 8 Region: 1169-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000322
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 9 Region: 1078-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000487
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 10 Region: 1621-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000574
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 11 Region: 1348-1435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000419
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 12 Region: 1530-1617
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000713
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 13 Region: 1441-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000535
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|153946395|ref|NP_002151.2|
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000183
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00099
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00533
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00602
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00693
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 319-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.016
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0236
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0282
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0404
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153946395|ref|NP_002151.2|
Sequence length 2201
Comment tenascin precursor [Homo sapiens]
Sequence
MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNN
LGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGT
PYTVTLHGEVRGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWMATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences P24821
NP_002151.2.87134 NP_002151.2.92137 ENSP00000265131 gi|153946395|ref|NP_002151.2| ENSP00000265131 9606.ENSP00000265131 ENSP00000265131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]