SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153946409|ref|NP_001731.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153946409|ref|NP_001731.2|
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily EF-hand 7.14e-28
Family Calmodulin-like 0.0085
Further Details:      
 
Domain Number 2 Region: 185-238
Classification Level Classification E-value
Superfamily EF-hand 0.00000000693
Family Parvalbumin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153946409|ref|NP_001731.2|
Sequence length 271
Comment calretinin isoform 1 [Homo sapiens]
Sequence
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
PVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQL
TNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
Download sequence
Identical sequences A0A140VK08 P22676
ENSP00000307508 NP_001731.2.87134 NP_001731.2.92137 gi|153946409|ref|NP_001731.2| ENSP00000307508 9606.ENSP00000307508 ENSP00000307508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]