SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154091020|ref|NP_065922.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154091020|ref|NP_065922.3|
Domain Number 1 Region: 92-321
Classification Level Classification E-value
Superfamily L domain-like 2.1e-39
Family Leucine rich effector protein YopM 0.043
Further Details:      
 
Domain Number 2 Region: 645-755
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-25
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154091020|ref|NP_065922.3|
Sequence length 765
Comment leucine-rich repeat and calponin homology domain-containing protein 2 [Homo sapiens]
Sequence
MAASQGGGGNSGGGGCGGGGSSGGCGTAGGGGGGAGGGGGGGGGTLVVPIPVPTLFGQPF
PNGPPWNPGSLQPQHTVRSLDRALEEAGSSGILSLSGRKLRDFPGSGYDLTDTTQADLSR
NRFTEIPSDVWLFAPLETLNLYHNCIKTIPEAIKNLQMLTYLNISRNLLSTLPKYLFDLP
LKVLVVSNNKLVSIPEEIGKLKDLMELDISCNEIQVLPQQMGKLHSLRELNIRRNNLHVL
PDELGDLPLVKLDFSCNKVTEIPVCYRKLHHLQVIILDNNPLQVPPAQICLKGKVHIFKY
LNIQACCRMDKKPDSLDLPSLSKRMPSQPLTDSMEDFYPNKNHGPDSGIGSDNGEKRLST
TEPSDDDTVSLHSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQG
NAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQL
LQQEQKNRILNHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPW
PESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSDNANMSTQSPVSSEEYD
RTDGFSHSPFGLKPRSAFSRSSRQEYGAADPGFTMRRKMEHLREEREQIRQLRNNLESRL
KVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVENFLDACK
KLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSVA
Download sequence
Identical sequences Q5VUJ6
ENSP00000325091 gi|154091020|ref|NP_065922.3| NP_065922.3.87134 NP_065922.3.92137 ENSP00000325091 9606.ENSP00000325091 ENSP00000325091 ENSP00000470914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]