SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154146216|ref|NP_067636.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154146216|ref|NP_067636.1|
Domain Number 1 Region: 138-298
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-33
Family Pleckstrin-homology domain (PH domain) 0.0000479
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily PH domain-like 7.05e-23
Family Pleckstrin-homology domain (PH domain) 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154146216|ref|NP_067636.1|
Sequence length 425
Comment pleckstrin homology domain-containing family A member 2 [Homo sapiens]
Sequence
MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGG
GLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILR
RSQSYIPTSGCRASTGPPLIKSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQADSPEDMHSWIKEIGAAVQAL
KCHPRETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSVASSWQPWTPV
PQAGEKLLPPGDTSEDSLFTPRPGEGSAPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENI
RTSDV
Download sequence
Identical sequences A8K727
gi|154146216|ref|NP_067636.1| 9606.ENSP00000393860 ENSP00000393860 ENSP00000393860 NP_067636.1.87134 NP_067636.1.92137 XP_011542907.1.92137 XP_011542908.1.92137 XP_011542909.1.92137 ENSP00000482228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]