SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154800478|ref|NP_001094093.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154800478|ref|NP_001094093.1|
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-22
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154800478|ref|NP_001094093.1|
Sequence length 222
Comment pleckstrin homology domain-containing family B member 2 isoform 3 [Homo sapiens]
Sequence
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQ
ECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMT
DETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLY
GQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF
Download sequence
Identical sequences A0A024QZ35 Q96CS7
ENSP00000386662 ENSP00000386666 gi|154800478|ref|NP_001094093.1| ENSP00000385892 ENSP00000386662 ENSP00000386666 NP_001094093.1.87134 NP_001094093.1.92137 XP_016859901.1.92137 9606.ENSP00000385892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]