SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154816208|ref|NP_001094288.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154816208|ref|NP_001094288.1|
Domain Number 1 Region: 54-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000635
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154816208|ref|NP_001094288.1|
Sequence length 217
Comment PTB-containing, cubilin and LRP1-interacting protein isoform 2 [Homo sapiens]
Sequence
MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKV
TYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
Download sequence
Identical sequences A0A096MS60 A0A0D9R3Y1 A0A2I2ZN18 A0A2K5K3M1 A0A2K5NAE2 A0A2K5RT07 A0A2K5VY79 A0A2K5XIE0 A0A2K6CVK7 A0A2K6M055 A0A2K6RDN1 A0A2K6V552 H9EM06 K7DGI2 K7ETN2
ENSPPYP00000023905 ENSP00000375908 gi|154816208|ref|NP_001094288.1| ENSPANP00000002621 ENSP00000375908 NP_001094288.1.87134 NP_001094288.1.92137 NP_001252812.1.72884 XP_003776150.1.23681 XP_003925500.1.74449 XP_004033355.1.27298 XP_007964720.1.81039 XP_010369073.1.97406 XP_011807349.1.43180 XP_011824534.1.47321 XP_011927948.1.92194 XP_015288400.1.63531 XP_017384571.1.71028 XP_017718586.1.44346 XP_526050.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]