SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15529980|ref|NP_219481.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15529980|ref|NP_219481.1|
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily L domain-like 3.23e-27
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15529980|ref|NP_219481.1|
Sequence length 321
Comment leucine-rich repeat-containing protein 46 [Homo sapiens]
Sequence
MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIR
NLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSEN
LIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDE
ASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLP
GVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATA
PKASVAEAPSTTKTTAKRSKK
Download sequence
Identical sequences Q96FV0
ENSP00000269025 9606.ENSP00000269025 ENSP00000269025 gi|15529980|ref|NP_219481.1| ENSP00000269025 GO.40160 NP_219481.1.87134 NP_219481.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]