SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156104893|ref|NP_597703.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156104893|ref|NP_597703.2|
Domain Number 1 Region: 444-556
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00048
Further Details:      
 
Domain Number 2 Region: 260-321,384-429
Classification Level Classification E-value
Superfamily PH domain-like 8.52e-20
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 3 Region: 568-658
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-16
Family Ankyrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156104893|ref|NP_597703.2|
Sequence length 663
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 [Homo sapiens]
Sequence
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVRFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHIMK
KRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYM
KNIHKKEIDLQTSTIKVPGKWPSLATSACTPISTSKSNGLSKDMDTGLGDSICFSPSISS
TTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSKAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDLQTAILLLAHGSREEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
KCV
Download sequence
Identical sequences Q96P64
ENSP00000392513 ENSP00000343438 ENSP00000392513 gi|156104893|ref|NP_597703.2| 9606.ENSP00000392513 NP_597703.2.87134 NP_597703.2.92137 ENSP00000343438 ENSP00000392513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]