SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156616273|ref|NP_002655.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156616273|ref|NP_002655.2|
Domain Number 1 Region: 243-347
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-30
Family Pleckstrin-homology domain (PH domain) 0.00000255
Further Details:      
 
Domain Number 2 Region: 116-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.52e-29
Family DEP domain 0.000000898
Further Details:      
 
Domain Number 3 Region: 4-102
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-25
Family Pleckstrin-homology domain (PH domain) 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156616273|ref|NP_002655.2|
Sequence length 350
Comment pleckstrin [Homo sapiens]
Sequence
MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQ
DFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRL
PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMI
ASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE
FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSV
ESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK
Download sequence
Identical sequences P08567
ENSP00000234313 9606.ENSP00000234313 ENSP00000234313 ENSP00000234313 gi|156616273|ref|NP_002655.2| NP_002655.2.87134 NP_002655.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]