SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|156938287|ref|NP_001096631.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156938287|ref|NP_001096631.1|
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-27
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 2 Region: 267-388
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000733
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156938287|ref|NP_001096631.1|
Sequence length 423
Comment SH2 domain-containing protein 5 isoform 1 [Homo sapiens]
Sequence
MQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVWLVQQQLWALKDCPR
RRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAFMARNPRSPASKLFC
HLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEERAQPEPCPGPTGEVPLKPLSSSGGLVR
EPFGRDQLSQNVHALVSFRRLPAEGLVGSGKELPESEGRARHARLGNPYCSPTLVRKKAI
RSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGHSCLVESEGSLTENIWAFAG
ISRPCALALLRRDVLGAFLLWPELGASGQWCLSVRTQCGVVPHQVFRNHLGRYCLEHLPA
EFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCGPPGRPPRTLRPLSHAKSEAELQ
GLG
Download sequence
Identical sequences H2PY90 Q6ZV89
gi|156938287|ref|NP_001096631.1| ENSP00000406026 9606.ENSP00000408509 NP_001096631.1.87134 NP_001096631.1.92137 XP_008965309.1.60992 XP_011539761.1.92137 XP_011539762.1.92137 XP_011539763.1.92137 XP_016810973.1.37143 XP_016810979.1.37143 ENSP00000406026 ENSP00000406026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]