SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157384973|ref|NP_003276.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157384973|ref|NP_003276.3|
Domain Number 1 Region: 1126-1346
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 9.16e-86
Family Fibrinogen C-terminal domain-like 0.000000844
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-24
Family Fibronectin type III 0.00000975
Further Details:      
 
Domain Number 3 Region: 955-1123
Classification Level Classification E-value
Superfamily Fibronectin type III 4.63e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 778-937
Classification Level Classification E-value
Superfamily Fibronectin type III 3.4e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 328-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 502-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000104
Family Fibronectin type III 0.00000385
Further Details:      
 
Weak hits

Sequence:  gi|157384973|ref|NP_003276.3|
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000178
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.009
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157384973|ref|NP_003276.3|
Sequence length 1358
Comment tenascin-R precursor [Homo sapiens]
Sequence
MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPRGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
Download sequence
Identical sequences Q92752
ENSP00000263525 ENSP00000356646 NP_003276.3.87134 NP_003276.3.92137 XP_016857707.1.92137 XP_016857708.1.92137 ENSP00000263525 ENSP00000356646 gi|157384973|ref|NP_003276.3| 9606.ENSP00000263525 NYSGRC-157384973 ENSP00000263525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]