SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157419122|ref|NP_002281.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157419122|ref|NP_002281.2|
Domain Number 1 Region: 1629-1815
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-35
Family Laminin G-like module 0.00051
Further Details:      
 
Domain Number 2 Region: 1451-1627
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1040-1222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.11e-23
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 1230-1374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.93e-21
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 5 Region: 826-1023
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-18
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 6 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 8 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|157419122|ref|NP_002281.2|
Domain Number - Region: 731-799
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0222
Family FAT domain of focal adhesion kinase 0.018
Further Details:      
 
Domain Number - Region: 462-504
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0929
Family RecG, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157419122|ref|NP_002281.2|
Sequence length 1816
Comment laminin subunit alpha-4 isoform 2 precursor [Homo sapiens]
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGCDKCVWDLTDALRLAALSIEEGKSGVLSVSSGAAA
HRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKENQASRKG
QLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKLVLAQKML
EEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDDYNAKLSD
LQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADSLTTPRLT
LSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQEANELSRK
LHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDTQIIYHKD
ESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQAAERGDA
QQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNSARDAVRN
LTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDGQSAVEVH
SRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIKNDNLVYV
YNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEFS
GDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYNFKHIYNM
DPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVRTPADNGL
ILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEISIIYHNDK
KMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRGCMKGFQF
QKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFNFRTLQ
PNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVSPTRYELI
VDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVDRDVEVED
FQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWDPVALKLP
ERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLRTRSSHGM
IFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIRERSSGRL
VIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSNLQLNGAS
ITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLVH
GHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQLDV
DSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDGHPVSFSK
AALVSGAVSINSCPAA
Download sequence
Identical sequences gi|157419122|ref|NP_002281.2| gi|157419126|ref|NP_001098677.1| ENSP00000374114 ENSP00000416470 ENSP00000429488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]