SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157419124|ref|NP_001098676.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157419124|ref|NP_001098676.1|
Domain Number 1 Region: 1636-1822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-35
Family Laminin G-like module 0.00051
Further Details:      
 
Domain Number 2 Region: 1458-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1047-1229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.24e-23
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 1237-1381
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.93e-21
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 5 Region: 833-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-18
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 6 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000215
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 8 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000301
Family Laminin-type module 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|157419124|ref|NP_001098676.1|
Domain Number - Region: 738-806
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0222
Family FAT domain of focal adhesion kinase 0.018
Further Details:      
 
Domain Number - Region: 469-511
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0929
Family RecG, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157419124|ref|NP_001098676.1|
Sequence length 1823
Comment laminin subunit alpha-4 isoform 1 precursor [Homo sapiens]
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDALRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLLSDVEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVSEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRFDIEVR
TPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences Q16363
ENSP00000230538 ENSP00000230538 9606.ENSP00000230538 gi|157419124|ref|NP_001098676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]