SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157419154|ref|NP_002996.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157419154|ref|NP_002996.2|
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-28
Family C-type lectin domain 0.000000238
Further Details:      
 
Domain Number 2 Region: 262-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-16
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 565-630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000001
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 503-569
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 441-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 200-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 8 Region: 378-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 642-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000987
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 10 Region: 697-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000542
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 11 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157419154|ref|NP_002996.2|
Sequence length 830
Comment P-selectin precursor [Homo sapiens]
Sequence
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences A0A024R8Y9
ENSP00000263686 9606.ENSP00000263686 gi|157419154|ref|NP_002996.2| NYSGRC-LECT-ENSP00000356764 NP_002996.2.87134 NP_002996.2.92137 XP_005245492.1.92137 XP_005245493.1.92137 ENSP00000263686 ENSP00000356762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]