SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157426829|ref|NP_001094861.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157426829|ref|NP_001094861.1|
Domain Number 1 Region: 29-362
Classification Level Classification E-value
Superfamily L domain-like 1.59e-61
Family Ngr ectodomain-like 0.0048
Further Details:      
 
Domain Number 2 Region: 403-501
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-21
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157426829|ref|NP_001094861.1|
Sequence length 592
Comment leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 precursor [Homo sapiens]
Sequence
MTCWLCVLSLPLLLLPAAPPPAGGCPARCECTVQTRAVACTRRRLTAVPDGIPAETRLLE
LSRNRIRCLNPGDLAALPALEELDLSENAIAHVEPGAFANLPRLRVLRLRGNQLKLIPPG
VFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLEVGDNDLVFVSRRAFAGLLALEELT
LERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGLLHLEIDNWPLLEEVAA
GSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELH
LAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTLETLRVDGNPLACDCRL
LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTAT
AGEDVRFLCRAEGEPAPTVAWVTPQHRPVTATSAGRARVLPGGTLEIQDARPQDSGTYTC
VASNAGGNDTYFATLTVRPEPAANRTPGEAHNETLAALRAPLDLTTILVSTAMGCITFLG
VVLFCFVLLFVWSRGRGQHKNNFSVEYSFRKVDGPAAAAGQGGARKFNMKMI
Download sequence
Identical sequences P0C6S8
ENSP00000467753 NYSGRC-IgSF-LIGO3_HUMAN gi|157426829|ref|NP_001094861.1| 9606.ENSP00000384979 NP_001094861.1.87134 NP_001094861.1.92137 ENSP00000384979 ENSP00000467753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]