SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157738667|ref|NP_078789.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157738667|ref|NP_078789.2|
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-40
Family RUN domain 0.00066
Further Details:      
 
Domain Number 2 Region: 1362-1476
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1169-1233
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|157738667|ref|NP_078789.2|
Domain Number - Region: 869-1074
Classification Level Classification E-value
Superfamily Tropomyosin 0.000111
Family Tropomyosin 0.00059
Further Details:      
 
Domain Number - Region: 374-546
Classification Level Classification E-value
Superfamily Tropomyosin 0.0131
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157738667|ref|NP_078789.2|
Sequence length 1478
Comment FYVE and coiled-coil domain-containing protein 1 [Homo sapiens]
Sequence
MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFAR
RTLTTGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALEGFDEMRLELD
QLEVREKQLRERMQQLDRENQELRAAVSQQGEQLQTERERGRTAAEDNVRLTCLVAELQK
QWEVTQATQNTVKELQTCLQGLELGAAEKEEDYHTALRRLESMLQPLAQELEATRDSLDK
KNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSDAAQEMQELGEKLQALERERTKVEEV
NRQQSAQLEQLVKELQLKEDARASLERLVKEMAPLQEELSGKGQEADQLWRRLQELLAHT
SSWEEELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLI
QDKDHLSQQVGMLERLAGPPGPELPVAGEKNEALVPVNSSLQEAWGKPEEEQRGLQEAQL
DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQGSL
ASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEAILQSKEGECQQLREEVEQCQ
QLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQLALSQAQLEV
HQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALNRA
HVQELLQCSEREGALQEERADEAQQREEELRALQEELSQAKCSSEEAQLEHAELQEQLHR
ANTDTAELGIQVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKES
LQEKLKAAKAAAGSLPGLQAQLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQSRLKN
AGEECKSLRGQLEEQGRQLQAAEEAVEKLKATQADMGEKLSCTSNHLAECQAAMLRKDKE
GAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEER
LIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGR
IFCYYCCNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGP
QATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTST
SLTPEDTEDMPVGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPIT
VAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRT
PGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL
Download sequence
Identical sequences Q9BQS8
9606.ENSP00000296137 ENSP00000296137 gi|157738667|ref|NP_078789.2| NP_078789.2.87134 NP_078789.2.92137 XP_006713396.1.92137 XP_006713397.1.92137 XP_011532413.1.92137 ENSP00000296137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]