SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157743275|ref|NP_113656.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157743275|ref|NP_113656.2|
Domain Number 1 Region: 72-199
Classification Level Classification E-value
Superfamily EF-hand 1.29e-25
Family Calmodulin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157743275|ref|NP_113656.2|
Sequence length 261
Comment calcium-binding protein 8 isoform 1 [Homo sapiens]
Sequence
MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
Download sequence
Identical sequences A0A2I2ZYF8 H2QUP0
ENSPTRP00000032917 ENSP00000378690 ENSP00000378690 gi|157743275|ref|NP_113656.2| ENSP00000378690 ENSP00000391882 9598.ENSPTRP00000032917 9606.ENSP00000378690 ENSPTRP00000032917 NP_113656.2.87134 NP_113656.2.92137 XP_008961619.1.60992 XP_009451613.1.37143 XP_016813122.1.37143 XP_016868164.1.92137 XP_016868165.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]