SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157743290|ref|NP_001099051.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157743290|ref|NP_001099051.1|
Domain Number 1 Region: 59-281
Classification Level Classification E-value
Superfamily L domain-like 1.47e-40
Family Internalin LRR domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157743290|ref|NP_001099051.1|
Sequence length 301
Comment leucine-rich repeat-containing protein 30 [Homo sapiens]
Sequence
MGARQSRASSKDKGPKRMLFTGRRQKFSPWDDALLSGRDPRSLLKRGMHHVSFSLVTRGM
TDIPDFLWGLSEVQKLNLSHNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLK
VLFVNMNCLTEVPAELSLCRKLEVLSLSHNCLSQLPACFADLSRLRKLNLSNNFFAHIPM
CVFSLKELIFLHVGSNRLENIAESIQHLASLQIFIAEGNNIHSFPRSLCLVTSLELLNLN
NNDIQTLPSELHLLCRLVRIAWNPMDKGLHISHNPLSKPLPELVEGGLEMLFGYLKDKKH
T
Download sequence
Identical sequences A6NM36
ENSP00000372959 gi|157743290|ref|NP_001099051.1| ENSP00000372959 9606.ENSP00000372959 ENSP00000372959 NP_001099051.1.87134 NP_001099051.1.92137 XP_003817960.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]