SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157785649|ref|NP_001099129.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157785649|ref|NP_001099129.1|
Domain Number 1 Region: 24-162
Classification Level Classification E-value
Superfamily L domain-like 2.52e-22
Family Internalin LRR domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157785649|ref|NP_001099129.1|
Sequence length 624
Comment leucine-rich repeat and IQ domain-containing protein 3 [Homo sapiens]
Sequence
MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNN
FITDIHPLQSCIKLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYLHDNGFAKLKNICVLSA
CPTLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHR
LFFNFCPALRKGTTYEEEINNIKHITSKINAILAHNSPVLIVQRWIRGFLVRKNLSPVFF
HKKKQQEKIIRGYEAKWIYITKGYEDKLLKDLFFKPETNIKGKLAYWKHNIYYPVDLKNS
SEHRKHVSSILCELKPKDLGMKSKTSRHLIQKGQESEDEIVDEKLDTSFRISVFKLPIYT
SGSLKNNAVLREKKQHFFPAYPQPIYTTHPKPIIKKDIRLERSMKEFFAPQRAGMKLRTF
SDIDKYYTEQKKQEYHKEKVRVVAMAQVARERVRVAVNEHLNQKKYATQKLIEENKETIQ
NSLRQVWQNRFNYLEKARERKALFLKEKSQKASERLLVQNLNNERTLLTRGLLKIDRLEK
NEAVLKEKSLIVKQKLKAEKYRKNLLKEMKKVRSQEIYKRHCEEKFVMDMIAFEKACERL
QDAKTKVAIVKTNLDFKVPNGLIK
Download sequence
Identical sequences A6PVS8
NP_001099129.1.87134 NP_001099129.1.92137 ENSP00000346414 gi|157785649|ref|NP_001099129.1| ENSP00000346414 ENSP00000378524 ENSP00000346414 ENSP00000378524 9606.ENSP00000346414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]