SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15809016|ref|NP_291024.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15809016|ref|NP_291024.1|
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily EF-hand 4.82e-42
Family Calmodulin-like 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15809016|ref|NP_291024.1|
Sequence length 172
Comment myosin regulatory light chain 12B [Homo sapiens]
Sequence
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A096NC68 A0A0D9RYD7 A0A0G2JSW0 A0A1S2ZIM3 A0A1S3G3L6 A0A1U7UVZ0 A0A2I3GRY6 A0A2K5KBZ1 A0A2K5LT34 A0A2K5PFD0 A0A2K5W4I1 A0A2K5XNM9 A0A2K6GXT0 A0A2K6LC16 A0A2K6NJ22 F1SM78 F6RFU8 F7GDT3 F7IJT9 G1P466 G3IA94 G3R718 G3SU36 G5CAY1 H0V8P3 H2NVY0 H2QE79 I3M6T5 L5K200 L5LZU5 L9L2U8 M3XE65 O14950 Q3THE2 S7MXC3
ENSPTRP00000016741 ENSOCUP00000012567 ENSSSCP00000003997 ENSP00000237500 ENSP00000383037 ENSP00000463559 ENSP00000464464 ENSRNOP00000045992 ENSRNOP00000045992 ENSTSYP00000009507 ENSGGOP00000003975 ENSFCAP00000024921 ENSPPYP00000010135 ENSDNOP00000011258 gi|15809016|ref|NP_291024.1| gi|222144324|ref|NP_001138416.1| gi|222144326|ref|NP_001138417.1| ENSMUSP00000042364 ENSMMUP00000018081 ENSSSCP00000003997 ENSP00000237500 ENSLAFP00000003628 ENSSTOP00000005242 ENSNLEP00000008414 ENSPPYP00000010135 ENSMLUP00000004735 ENSMODP00000026817 ENSMUSP00000042364 10090.ENSMUSP00000042364 10116.ENSRNOP00000045992 13616.ENSMODP00000026817 9361.ENSDNOP00000005420 9544.ENSMMUP00000018081 9598.ENSPTRP00000016741 9600.ENSPPYP00000010135 9606.ENSP00000237500 9986.ENSOCUP00000017796 ENSTSYP00000009507 ENSMICP00000016286 ENSMICP00000016286 ENSDNOP00000005420 ENSPTRP00000016741 ENSSTOP00000005242 ENSMODP00000026817 ENSMLUP00000004735 ENSEEUP00000006342 ENSP00000237500 ENSP00000383037 ENSP00000463559 ENSP00000464464 ENSNLEP00000008413 ENSMUSP00000042364 HGL_H00000237500-3 ENSEEUP00000006342 ENSCJAP00000023637 ENSLAFP00000003628 ENSCJAP00000023637 ENSCJAP00000043194 ENSGGOP00000003975 NP_001138416.1.87134 NP_001138416.1.92137 NP_001138417.1.87134 NP_001138417.1.92137 NP_001252888.1.72884 NP_059039.2.100692 NP_059039.2.4139 NP_075891.1.92730 NP_291024.1.87134 NP_291024.1.92137 XP_001145151.2.37143 XP_001364033.1.35504 XP_002713645.1.1745 XP_002757131.1.60252 XP_002828122.1.23681 XP_003127889.1.46622 XP_003262075.1.23891 XP_003262077.1.23891 XP_003262078.1.23891 XP_003406418.1.64505 XP_003464510.1.53824 XP_003511936.1.69978 XP_003760078.1.9362 XP_003817939.1.60992 XP_004059180.1.27298 XP_004059183.1.27298 XP_004087793.1.23891 XP_004474455.1.11602 XP_004662709.1.11716 XP_004853248.1.39548 XP_004853249.1.39548 XP_005337172.1.77405 XP_005367613.1.66349 XP_005868803.1.60319 XP_006089321.1.53796 XP_006146551.1.99106 XP_006205195.1.17985 XP_006761922.1.95426 XP_006920120.1.64745 XP_006972320.1.50099 XP_007519928.1.11023 XP_007631570.1.28591 XP_007972722.1.81039 XP_008072948.1.4292 XP_008259338.1.1745 XP_008578507.1.73410 XP_008832841.1.79516 XP_008832842.1.79516 XP_008832843.1.79516 XP_008977810.1.60252 XP_009250546.1.23681 XP_010351500.1.97406 XP_010956383.1.22495 XP_010974744.1.51371 XP_011286390.1.62641 XP_011378036.1.92234 XP_011813184.1.43180 XP_011813185.1.43180 XP_011813186.1.43180 XP_011813187.1.43180 XP_011851718.1.47321 XP_011851719.1.47321 XP_011851720.1.47321 XP_011911608.1.92194 XP_012373424.1.11602 XP_012507567.1.63892 XP_012601550.1.48125 XP_012601552.1.48125 XP_012882637.1.60039 XP_013854702.1.46622 XP_014311762.1.53796 XP_014397162.1.60319 XP_014397163.1.60319 XP_014397164.1.60319 XP_014397165.1.60319 XP_014442543.1.99106 XP_014923936.1.86478 XP_015338010.1.40921 XP_015396277.1.5354 XP_016012539.1.101085 XP_016066972.1.3490 XP_016788882.1.37143 XP_016788883.1.37143 XP_016788884.1.37143 XP_017381569.1.71028 XP_017381570.1.71028 XP_017531868.1.32401 XP_017733814.1.44346 XP_017819393.1.60252 XP_019273917.1.44245 XP_019520667.1.44202 XP_019611278.1.88060 XP_020019283.1.5219 XP_020019284.1.5219 XP_020019285.1.5219 XP_020025305.1.5219 XP_020951792.1.46622 XP_021073287.1.100879 XP_021482187.1.76796 XP_021482188.1.76796 ENSMMUP00000018081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]