SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16306591|ref|NP_036295.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16306591|ref|NP_036295.1|
Domain Number 1 Region: 32-192
Classification Level Classification E-value
Superfamily RNI-like 7.26e-25
Family 28-residue LRR 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16306591|ref|NP_036295.1|
Sequence length 223
Comment leucine-rich repeat-containing protein 29 [Homo sapiens]
Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTK
DACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVA
VARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQL
RVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
Download sequence
Identical sequences A0A024R6W8 Q8WV35
gi|16306591|ref|NP_036295.1| gi|51873034|ref|NP_001004055.1| ENSP00000344364 ENSP00000344364 ENSP00000377561 ENSP00000386622 ENSP00000387318 NP_001004055.1.87134 NP_001004055.1.92137 NP_036295.1.87134 NP_036295.1.92137 XP_016878620.1.92137 XP_016878621.1.92137 XP_016878622.1.92137 XP_016878623.1.92137 9606.ENSP00000344364 ENSP00000377561 ENSP00000386622 ENSP00000387318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]