SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163644311|ref|NP_055999.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163644311|ref|NP_055999.2|
Domain Number 1 Region: 300-609
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.79e-121
Family Mammalian PLC 0.000000281
Further Details:      
 
Domain Number 2 Region: 140-299
Classification Level Classification E-value
Superfamily EF-hand 2.28e-42
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 629-754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.68e-30
Family PLC-like (P variant) 0.00029
Further Details:      
 
Domain Number 4 Region: 11-124
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-29
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163644311|ref|NP_055999.2|
Sequence length 1001
Comment inactive phospholipase C-like protein 2 isoform 2 [Homo sapiens]
Sequence
MPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKI
DIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGL
RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTS
KIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMF
LEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQ
DMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYT
GHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTT
SPNVEESYLPSPDVLKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKENMEQPNN
VPVKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFNEVLASKYANENPGDFVN
YNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGY
VLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVE
IHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYT
IPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYA
SLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPR
FLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIV
HCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLK
QIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE
Download sequence
Identical sequences H2QM57
ENSP00000412836 ENSP00000379979 NP_055999.2.87134 NP_055999.2.92137 XP_003826237.1.60992 XP_008949906.1.60992 XP_016861514.1.92137 ENSPTRP00000025314 gi|163644311|ref|NP_055999.2| 9598.ENSPTRP00000025314 9606.ENSP00000409637 ENSPTRP00000025314 ENSP00000409637 ENSP00000412836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]