SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163792208|ref|NP_055263.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163792208|ref|NP_055263.2|
Domain Number 1 Region: 266-486
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-57
Family DBL homology domain (DH-domain) 0.0000809
Further Details:      
 
Domain Number 2 Region: 476-622
Classification Level Classification E-value
Superfamily PH domain-like 3.73e-18
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 629-689
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000427
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163792208|ref|NP_055263.2|
Sequence length 709
Comment rho guanine nucleotide exchange factor 16 [Homo sapiens]
Sequence
MAQRHSDSSLEEKLLGHRFHSELRLDAGGNPASGLPMVRGSPRVRDDAAFQPQVPAPPQP
RPPGHEEPWPIVLSTESPAALKLGTQQLIPKSLAVASKAKTPARHQSFGAAVLSREAARR
DPKLLPAPSFSLDDMDVDKDPGGMLRRNLRNQSYRAAMKGLGKPGGQGDAIQLSPKLQAL
AEEPSQPHTRSPAKNKKTLGRKRGHKGSFKDDPQLYQEIQERGLNTSQESDDDILDESSS
PEGTQKVDATIVVKSYRPAQVTWSQLPEVVELGILDQLSTEERKRQEAMFEILTSEFSYQ
HSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDIS
DILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFL
ILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYT
LHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKK
KSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLL
SSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQ
QEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV
Download sequence
Identical sequences Q5VV41
ENSP00000367629 gi|163792208|ref|NP_055263.2| ENSP00000367629 NP_055263.2.87134 NP_055263.2.92137 XP_016856539.1.92137 XP_016856540.1.92137 9606.ENSP00000367629 ENSP00000367622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]