SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16418445|ref|NP_443185.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16418445|ref|NP_443185.1|
Domain Number 1 Region: 48-175
Classification Level Classification E-value
Superfamily L domain-like 2.93e-26
Family Ngr ectodomain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16418445|ref|NP_443185.1|
Sequence length 259
Comment leucine-rich repeat-containing protein 3B precursor [Homo sapiens]
Sequence
MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPR
DLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDL
SDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEH
AGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLK
SLPSRQKKADEPDDISTVV
Download sequence
Identical sequences A0A024R2R0 A0A091D604 A0A096NCX6 A0A0D9SC54 A0A1S2ZC75 A0A1S3EPI5 A0A1U7UIM7 A0A250XX52 A0A2K5C2T0 A0A2K5H9X1 A0A2K5KZF2 A0A2K5RJA2 A0A2K5XX14 A0A2K6CZV2 A0A2K6K4N7 A0A2K6QIU5 A0A2K6S2A9 D2H3M9 F1PT48 F2Z5C4 F6Q3B4 F6YZR1 F7G9Q9 G1QUN4 G5BFA4 G7NYA0 H0W1I7 H2PBB2 H2QM76 I3MGC9 K9IZB6 L5MHH7 L9KJ69 M3WLQ1 M3Z6I8 Q96PB8 U6CPM4
ENSSSCP00000011965 ENSAMEP00000021143 ENSMMUP00000022929 ENSNLEP00000004654 ENSECAP00000019736 ENSFCAP00000013895 ENSMPUP00000019201 ENSMPUP00000019201 ENSCJAP00000007456 ENSP00000379880 ENSDNOP00000023470 ENSPPYP00000015729 ENSPTRP00000025359 ENSSARP00000002451 NP_001180910.1.72884 NP_001304737.1.87134 NP_001304737.1.92137 NP_001304738.1.87134 NP_001304738.1.92137 NP_001304739.1.87134 NP_001304739.1.92137 NP_001304740.1.87134 NP_001304740.1.92137 NP_443185.1.87134 NP_443185.1.92137 XP_001093813.1.72884 XP_001164973.1.37143 XP_001493877.1.31192 XP_002759714.1.60252 XP_002814038.1.23681 XP_002814039.1.23681 XP_002814040.1.23681 XP_002916255.1.58354 XP_003132124.1.46622 XP_003256827.1.23891 XP_003256828.1.23891 XP_003256829.1.23891 XP_003480210.1.53824 XP_003936093.1.74449 XP_004087982.1.23891 XP_004417087.1.74151 XP_004417088.1.74151 XP_004419491.1.5094 XP_004474582.1.11602 XP_004474583.1.11602 XP_004603893.1.94378 XP_004634254.1.9945 XP_004661351.1.11716 XP_004754386.1.14098 XP_004754387.1.14098 XP_004754388.1.14098 XP_004754389.1.14098 XP_004754390.1.14098 XP_004754391.1.14098 XP_004754392.1.14098 XP_004754393.1.14098 XP_004754394.1.14098 XP_004754395.1.14098 XP_004754396.1.14098 XP_004857855.1.39548 XP_005264906.1.92137 XP_005264907.1.92137 XP_005317336.1.77405 XP_005387555.1.28644 XP_005545668.1.63531 XP_005545670.1.63531 XP_005545672.1.63531 XP_005545673.1.63531 XP_005545674.1.63531 XP_005545675.1.63531 XP_005545677.1.63531 XP_005545678.1.63531 XP_005600946.1.31192 XP_005600948.1.31192 XP_005634403.1.84170 XP_005634404.1.84170 XP_005634405.1.84170 XP_005634406.1.84170 XP_005669367.1.46622 XP_005669368.1.46622 XP_005669369.1.46622 XP_006153377.1.99106 XP_006153378.1.99106 XP_006153379.1.99106 XP_006176354.1.101512 XP_006205377.1.17985 XP_006745386.1.47382 XP_006753411.1.95426 XP_006753412.1.95426 XP_006753414.1.95426 XP_006851676.1.41390 XP_007097526.1.5354 XP_007097527.1.5354 XP_007517127.1.11023 XP_007934509.1.48129 XP_008007494.1.81039 XP_008007495.1.81039 XP_008007496.1.81039 XP_008007497.1.81039 XP_008007498.1.81039 XP_008007499.1.81039 XP_008070010.1.4292 XP_008151900.1.99482 XP_008533967.1.77740 XP_008533968.1.77740 XP_008533969.1.77740 XP_008533970.1.77740 XP_008533971.1.77740 XP_008533972.1.77740 XP_008533973.1.77740 XP_008533974.1.77740 XP_008533975.1.77740 XP_008587718.1.73410 XP_008707597.1.72690 XP_008707605.1.72690 XP_008707612.1.72690 XP_008707619.1.72690 XP_008949871.1.60992 XP_008949873.1.60992 XP_008982172.1.60252 XP_009237540.1.23681 XP_009237541.1.23681 XP_009443312.1.37143 XP_010344853.1.74449 XP_010356314.1.97406 XP_010638473.1.5607 XP_010638474.1.5607 XP_010638475.1.5607 XP_010638476.1.5607 XP_010638477.1.5607 XP_010638478.1.5607 XP_010946045.1.22495 XP_010986112.1.51371 XP_011284571.1.62641 XP_011284572.1.62641 XP_011284573.1.62641 XP_011531634.1.92137 XP_011751767.1.29376 XP_011751768.1.29376 XP_011751769.1.29376 XP_011751770.1.29376 XP_011751771.1.29376 XP_011751772.1.29376 XP_011751773.1.29376 XP_011751774.1.29376 XP_011751775.1.29376 XP_011751776.1.29376 XP_011751777.1.29376 XP_011811620.1.43180 XP_011811621.1.43180 XP_011811622.1.43180 XP_011811623.1.43180 XP_011830205.1.47321 XP_011830207.1.47321 XP_011830208.1.47321 XP_011830209.1.47321 XP_011899202.1.92194 XP_011899203.1.92194 XP_011899204.1.92194 XP_011899205.1.92194 XP_011899206.1.92194 XP_011899208.1.92194 XP_011899209.1.92194 XP_011899210.1.92194 XP_011899211.1.92194 XP_011899212.1.92194 XP_011899213.1.92194 XP_011899214.1.92194 XP_011899215.1.92194 XP_012290997.1.9421 XP_012290998.1.9421 XP_012290999.1.9421 XP_012291000.1.9421 XP_012291001.1.9421 XP_012367161.1.23891 XP_012865873.1.60039 XP_012865875.1.60039 XP_012865876.1.60039 XP_012912630.1.14098 XP_012999181.1.53824 XP_012999182.1.53824 XP_012999183.1.53824 XP_012999184.1.53824 XP_013836879.1.46622 XP_013962285.1.84170 XP_013962286.1.84170 XP_014199638.1.60992 XP_014407497.1.101512 XP_014407498.1.101512 XP_014407499.1.101512 XP_014645512.1.5094 XP_014685340.1.49734 XP_014685341.1.49734 XP_014685342.1.49734 XP_014933471.1.86478 XP_014933472.1.86478 XP_014933473.1.86478 XP_014933474.1.86478 XP_014933475.1.86478 XP_014987751.1.72884 XP_014987752.1.72884 XP_014987753.1.72884 XP_014987754.1.72884 XP_014987755.1.72884 XP_015095600.1.17985 XP_015095601.1.17985 XP_015345114.1.40921 XP_015345115.1.40921 XP_015345116.1.40921 XP_015399926.1.5354 XP_015399927.1.5354 XP_015399928.1.5354 XP_015399929.1.5354 XP_015417596.1.95426 XP_015417601.1.95426 XP_016054285.1.3490 XP_016054286.1.3490 XP_016861164.1.92137 XP_017353716.1.71028 XP_017353718.1.71028 XP_017515092.1.32401 XP_017515093.1.32401 XP_017515094.1.32401 XP_017515095.1.32401 XP_017746112.1.44346 XP_017746119.1.44346 XP_017746126.1.44346 XP_017746137.1.44346 XP_017746146.1.44346 XP_017746149.1.44346 XP_017746152.1.44346 XP_017746154.1.44346 XP_017746164.1.44346 XP_017746171.1.44346 XP_017746181.1.44346 XP_017746188.1.44346 XP_017746196.1.44346 XP_019278451.1.44245 XP_019278452.1.44245 XP_019278453.1.44245 XP_019278454.1.44245 XP_019488392.1.44202 XP_019488394.1.44202 XP_019488395.1.44202 XP_019488396.1.44202 XP_019488397.1.44202 XP_019488398.1.44202 XP_019488399.1.44202 XP_019600861.1.88060 XP_019600862.1.88060 XP_019600863.1.88060 XP_019600864.1.88060 XP_019600865.1.88060 XP_019600866.1.88060 XP_019600867.1.88060 XP_019666353.1.62641 XP_019666354.1.62641 XP_020040050.1.5219 XP_020040051.1.5219 XP_020040052.1.5219 XP_020040053.1.5219 XP_020040054.1.5219 XP_020040055.1.5219 XP_020040056.1.5219 XP_020927111.1.46622 XP_020927112.1.46622 XP_021534488.1.83697 XP_021534489.1.83697 XP_021587336.1.77405 XP_021587342.1.77405 XP_021587348.1.77405 XP_021587352.1.77405 XP_021587354.1.77405 XP_021587359.1.77405 XP_021587362.1.77405 XP_542758.1.84170 ENSMMUP00000022929 ENSMMUP00000038352 ENSMMUP00000038353 ENSCAFP00000008470 gi|16418445|ref|NP_443185.1| ENSP00000379880 ENSP00000394940 ENSP00000406370 ENSTSYP00000001484 ENSCPOP00000016827 HGL_H00000379880 ENSTSYP00000001484 ENSSARP00000002451 ENSCJAP00000007465 ENSCJAP00000045496 ENSNLEP00000004654 ENSECAP00000019736 ENSCAFP00000008470 ENSSSCP00000011965 ENSPTRP00000025359 ENSPANP00000010695 ENSSTOP00000009794 ENSP00000379880 ENSP00000394940 ENSP00000406370 ENSDORP00000007084 ENSPPYP00000015729 ENSFCAP00000013895 ENSEEUP00000010798 ENSEEUP00000010798 10141.ENSCPOP00000016827 9544.ENSMMUP00000038352 9598.ENSPTRP00000025359 9600.ENSPPYP00000015729 9606.ENSP00000326763 9685.ENSFCAP00000013895 9796.ENSECAP00000019736 9823.ENSSSCP00000011965 ENSAMEP00000021143 ENSCPOP00000016827 ENSDORP00000007084 ENSSTOP00000009794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]