SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|164414437|ref|NP_001106699.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|164414437|ref|NP_001106699.1|
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 2 Region: 407-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000503
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  gi|164414437|ref|NP_001106699.1|
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0294
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|164414437|ref|NP_001106699.1|
Sequence length 480
Comment netrin-G1 isoform 2 [Homo sapiens]
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNPPKFNRIWPNISSLEVSNPKQVAPKLALSTVSSVQVANHKRANVCDNELLHCQNGGT
CHNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
Download sequence
Identical sequences A0A1D5QRK2 A0A2I2ZTW9 A0A2J8M4G5 A0A2K5K880 A0A2K5KVZ5 A0A2K5TR42 A0A2K5Z4U0 A0A2K6N755 X5DNW2
NP_001106699.1.87134 NP_001106699.1.92137 XP_005542607.1.63531 XP_006710518.1.92137 XP_007975967.1.81039 XP_008974022.1.60992 XP_011824269.1.47321 XP_011920773.1.92194 XP_011920774.1.92194 XP_015001703.1.72884 XP_015287455.1.63531 XP_016856172.1.92137 XP_016856173.1.92137 XP_018894267.1.27298 gi|164414437|ref|NP_001106699.1| ENSP00000359083 ENSP00000359088 ENSP00000359083 ENSP00000359088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]