SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|164519084|ref|NP_036329.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|164519084|ref|NP_036329.3|
Domain Number 1 Region: 553-712
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.2e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0076
Further Details:      
 
Domain Number 2 Region: 687-810
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 126-272
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-25
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 
Weak hits

Sequence:  gi|164519084|ref|NP_036329.3|
Domain Number - Region: 998-1032
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0602
Family Trimerization domain of TRAF 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|164519084|ref|NP_036329.3|
Sequence length 1069
Comment rab GTPase-activating protein 1 [Homo sapiens]
Sequence
MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIVGNGSEQQL
QKELADVLMDPPMDDQPGEKELVKRSQLDGEGDGPLSNQLSASSTINPVPLVGLQKPEMS
LPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQI
SLDVTLSVPNVSEGIVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNA
ELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKE
DDGKGYFSAVPKDKDRQCFKLRQGIDKKIVIYVQQTTNKELAIERCFGLLLSPGKDVRNS
DMHLLDLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQE
PVRFLLETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQRERKNNTDTLYEVVCLESE
SERERRKTTASPSVRLPQSGSQSSVIPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILET
WGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKES
PQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLL
HMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEA
HMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGAL
KFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEE
EKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIE
KIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQ
LVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
Download sequence
Identical sequences A0A2I3TNH7 G3QMT1 Q9Y3P9
NP_036329.3.87134 NP_036329.3.92137 XP_009455526.1.37143 XP_011516742.1.92137 XP_011516743.1.92137 XP_016817100.1.37143 XP_016870056.1.92137 XP_016870057.1.92137 XP_016870058.1.92137 XP_018889483.1.27298 XP_520242.3.37143 ENSP00000362747 ENSP00000362751 ENSPTRP00000036468 ENSGGOP00000003826 9598.ENSPTRP00000036468 9606.ENSP00000362751 ENSPTRP00000036468 ENSP00000362751 gi|164519084|ref|NP_036329.3| ENSGGOP00000003826 ENSGGOP00000025578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]